Sermorelin

$90.00

GHRH Analog Research Peptide

Availability: 28 in stock

Free Fridge Case Included
Discreet refrigerator storage for your research compounds.
Complimentary case size is selected based on the number of vials in your order.
Order with confidence
Ships from the United States
Batch COA available
Free shipping over $150
Live human support
Category:

Sermorelin / GHRH Analog Research Peptide

High-purity research compound.

  • Size: 10mg vial
  • Form: Lyophilized powder
  • Intended use: Laboratory research use only

Product Description: This vial contains 10mg of high-purity lyophilized Sermorelin, a synthetic growth hormone-releasing hormone analog commonly referenced in biochemical, endocrine, cellular signaling, and peptide receptor research. Sermorelin is a 29-amino-acid peptide associated with laboratory studies involving GHRH-related pathways, receptor activity, peptide stability, and controlled analytical research models.

Sermorelin acetate is commonly listed under CAS 114466-38-5, with the molecular formula C151H250N44O44S and an approximate molecular weight of 3417.9 g/mol. Its referenced amino acid sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2.

Sermorelin is a synthetic peptide research material. It is commonly referenced in biochemical literature as a short-chain GHRH analog used in controlled laboratory, analytical, and reference research settings.

Sermorelin is supplied as a lyophilized powder for laboratory research, analytical testing, and reference purposes only.

This product is not for human consumption.

For laboratory research use only. Not for human or animal consumption. Not for medical, veterinary, diagnostic, therapeutic, cosmetic, food, dietary supplement, or household use. This material is supplied only for lawful in-vitro research, analytical testing, and laboratory reference purposes. No directions for human or animal use are provided or implied.

Size

5mg, 10mg

0
    0
    Your Cart
    Your cart is emptyReturn to Shop
    Scroll to Top