Tesamorelin

Price range: $70.00 through $115.00

Synthetic GHRH Analog Research Peptide

Free Fridge Case Included
Discreet refrigerator storage for your research compounds.
Complimentary case size is selected based on the number of vials in your order.
Order with confidence
Ships from the United States
Batch COA available
Free shipping over $150
Live human support
SKU: N/A Category:

Tesamorelin / GHRH Analog Research Peptide

High-purity research compound.

  • Size: 5mg or 10mg vial
  • Form: Lyophilized powder
  • Intended use: Laboratory research use only

Product Description: This vial contains 5mg of high-purity lyophilized Tesamorelin, a synthetic analog of growth hormone-releasing hormone commonly referenced in biochemical, endocrine, cellular signaling, and peptide receptor research. Tesamorelin is a modified 44-amino-acid peptide associated with laboratory studies involving GHRH-related pathways and controlled analytical research models.

Tesamorelin is commonly listed under CAS 218949-48-5, with the molecular formula C221H366N72O67S and an approximate molecular weight of 5135.78 g/mol as the free-base peptide. Its referenced amino acid sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL.

Tesamorelin is a synthetic peptide research material. It is commonly referenced in biochemical literature as a long-chain peptide compound used in controlled laboratory and analytical research settings.

Tesamorelin is supplied as a lyophilized powder for laboratory research, analytical testing, and reference purposes only.

This product is not for human consumption.

For laboratory research use only. Not for human or animal consumption. Not for medical, veterinary, diagnostic, therapeutic, cosmetic, food, dietary supplement, or household use. This material is supplied only for lawful in-vitro research, analytical testing, and laboratory reference purposes. No directions for human or animal use are provided or implied.

Size

5mg, 10mg

0
    0
    Your Cart
    Your cart is emptyReturn to Shop
    Scroll to Top